A practical reference on epithalamin: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-02-02 and is reviewed periodically as new material appears.
Because epitalon has no pharmacopoeial monograph, quality assessment depends on supplier documentation and independent testing. Certificates of analysis typically report a purity figure from a single chromatographic run, a measured mass and sometimes an appearance description, but methods and acceptance criteria are not harmonised across vendors. Third-party laboratories can repeat identity and purity measurements, and mismatches between labelled and measured peptide content have been described for research peptides generally. What constitutes adequate identity confirmation for a molecule of this size stays an open question, since mass agreement alone does not separate closely related sequences.
Identity testing for epitalon relies on reversed-phase high-performance liquid chromatography for purity and mass spectrometry for mass confirmation. Because the sequence contains no tryptophan or tyrosine, ultraviolet detection at 280 nanometres is insensitive, so chromatographic methods usually monitor absorbance near 214 nanometres, where the peptide backbone absorbs. Electrospray ionisation or matrix-assisted laser desorption/ionisation then checks the intact mass against the expected value near 390 daltons. Peptide mapping or amino acid analysis after acid hydrolysis can supplement these measurements, although such confirmatory work is seldom reported on commercial certificates of analysis.
Stability of the tetrapeptide follows ordinary peptide chemistry rather than any unusual structural feature. The aspartate-glycine pair is prone to aspartimide formation under mildly basic or neutral conditions, and deamidation can follow, altering both mass and chromatographic retention. Dry lyophilised powder kept at or below minus twenty degrees Celsius is the usual handling recommendation, with repeated freeze-thaw cycles avoided. Once dissolved in neutral aqueous buffer, degradation proceeds over days to weeks depending on pH and temperature, while acidic conditions generally slow the aspartimide route. A formal stability-indicating study has not been published in the indexed literature.
Published studies on epitalon are dominated by a small number of research groups, and independent replication in other laboratories remains limited. Proposed mechanisms include activation of telomerase and modulation of melatonin rhythms, but the evidence for either rests mainly on cell cultures and animal models. Whether the peptide produces comparable effects in humans is an open question, and the absence of large controlled trials means the literature is best read as exploratory rather than settled.
Epitalon is a synthetic four-amino-acid peptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. Its molecular formula is C14H22N4O9, and its calculated molar mass is approximately 390.35 grams per mole. The compound is a short fragment related to a peptide fraction isolated from bovine pineal gland extracts, and it is normally supplied as a lyophilised powder intended for laboratory research. It is not a registered pharmaceutical product in most countries.
The peptide emerged from research carried out in Saint Petersburg from the late 1980s onward, where investigators searched for shorter active fragments of a pineal preparation known as epithalamin. The name epitalon was chosen to reflect that parent extract. Early reports described effects on neuroendocrine markers and on the lifespan of laboratory animals. Much of that work appeared in Russian-language journals, with English translations following later, which affects how readily the original protocols can be assessed by outside groups.
| Property | Value | Notes |
|---|---|---|
| Analytical method | Reversed-phase HPLC | Purity determination, typically 214 nm |
| Mass confirmation | ESI or MALDI mass spectrometry | Compared with mass near 390 Da |
| Common synonyms | Epitalon, epithalon, AEDG | Naming differs between suppliers |
| Storage temperature | −20 °C or lower | Lyophilised powder, kept desiccated |
| Solution stability | Limited in neutral aqueous buffer | Aspartimide and hydrolysis pathways |
Typical storage for the lyophilized powder is −20 °C or lower, in a sealed container protected from light and moisture. Hygroscopic material should be allowed to equilibrate to room temperature before the vial is opened, which limits condensation on the contents. Working solutions are commonly divided into single-use aliquots and frozen to avoid repeated freeze-thaw cycles. Dilute solutions are more prone to adsorption onto plastic surfaces and to loss during filtration, so procedures that minimize transfers and use low-binding labware are preferable.
Reversed-phase high-performance liquid chromatography is the standard approach for assessing purity, usually with ultraviolet detection near 214 nm, where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the molecular mass and helps reveal truncation or deletion byproducts. Amino acid analysis can verify composition, and counterion content is sometimes measured because peptides purified with trifluoroacetic acid retain variable amounts of that salt. Purity figures reported without a stated method and detection wavelength are difficult to interpret.
Material sold for research use varies widely in documented quality. A useful verification package includes a certificate of analysis that states peptide content rather than only net weight, the chromatographic method and column used, and a mass spectrum consistent with the expected mass. Independent testing by a third-party laboratory is occasionally reported. Statements of identity resting only on a supplier label provide little assurance, and the gap between nominal mass and actual peptide content can be substantial once counterions and residual water are counted.
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Epitalon is a synthetic tetrapeptide whose sequence is alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. It was developed in Russia during the 1980s and 1990s by investigators associated with the St. Petersburg Institute of Bioregulation and Gerontology, who studied short peptides as regulators of gene expression and tissue function. The alternative spelling epithalon appears interchangeably in the literature, and the two names refer to the same molecule. Outside Russia it is encountered chiefly as a research chemical rather than a licensed medicine, and it holds no approval from the United States Food and Drug Administration or the European Medicines Agency.
The peptide is a synthetic analogue of epithalamin, a preparation extracted from bovine pineal glands. Investigators sought a short, chemically defined molecule that would reproduce some of the endocrine and gerontological observations attributed to the glandular extract. Proposed mechanisms centre on induction of telomerase activity, an effect reported in cultured human somatic cells in the early 2000s, together with influences on melatonin secretion and neuroendocrine regulation. Those mechanisms remain incompletely characterised, and the reported telomerase response has not been consistently reproduced by independent groups working in comparable systems.
Animal and clinical reports appear mainly in Russian-language journals from the 1990s and 2000s, covering endpoints such as melatonin rhythm, lifespan in aged rodents, and retinal function. Many of these papers involve small groups, lack blinding or placebo comparison, and are difficult to retrieve through indexed databases. Review articles published in English generally summarise the claims without reanalysing the underlying data. Because no large randomised trial exists, the clinical importance of these reported effects stays unresolved and is properly described as an open question.
No national medicines regulator has approved epitalon as a therapeutic product. It is generally distributed as a research chemical, and in some jurisdictions selling peptides for human consumption without approval is restricted or prohibited. Certificates of analysis accompanying commercial material vary in which tests are performed, and independent verification of identity and purity is uncommon. Statements about anti-ageing or disease-prevention benefits on vendor pages are marketing claims rather than regulatory findings, a distinction that shapes how the compound is discussed in scientific and popular sources alike.
The most frequently cited laboratory finding is that AEDG increased telomerase activity and extended telomere length in cultured human somatic cells. That work used fetal fibroblast strains and reported changes in enzyme activity alongside altered division counts. Replication by unrelated groups has been limited, and the published record is largely a single-laboratory series rather than a multi-centre programme. The result supports a hypothesis about peptide influence on gene expression in cell culture; it does not by itself establish an effect on telomere length in living animals or in people.
Epitalon is a synthetic tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. Its design traces to epithalamin, a peptide fraction prepared from bovine pineal gland extracts that researchers in Saint Petersburg began investigating in the 1970s. The compound has a molecular formula of C14H22N4O9 and a nominal molecular mass near 390 daltons. It holds no approved drug status in the United States or the European Union, and material sold under this name is generally offered as a research chemical rather than a finished pharmaceutical product.
Proposed mechanisms centre on cell-culture observations rather than a defined receptor interaction. Several reports describe increased expression of the telomerase catalytic subunit after exposure of cultured human cells, and the authors attributed the effect to short peptide fragments entering the nucleus and influencing gene transcription. No receptor for the tetrapeptide has been identified, and the free peptide is expected to be degraded rapidly by plasma peptidases. Whether any measurable fraction reaches intact tissues after administration remains an unresolved question rather than an established finding.
=== September === September 15, 2011 Canada The St. Thomas Assembly plant was closed permanently after decades of providing employing to the region of St. Thomas, Ontario; resulting in the loss of roughly 1,400 good-paying jobs.
Boston Women's Health Book Collective (2011). Our bodies, ourselves. New York: Simon & Schuster. ISBN 978-1-4391-9066-1. Preview. Revill, Jo (17 August 2003). "The new nose job: designer vaginas". The Observer. Guardian Media Group. Rogers, Lisa (15 August 2008). "The quest for the perfect vagina". The Guardian. Lisa Rogers (writer and presenter) (17 August 2008). The Perfect Vagina (TV programme). The G-spot series. London: North One Television. Archived from the original on 16 May 2011. Retrieved 18 September 2011 – via Channel 4. Jones, Bethany; Nurka, Camille (January 2015). "Labiaplasty and pornography: a preliminary investigation". Porn Studies. 2 (1): 62–75. doi:10.1080/23268743.2014.984940. hdl:1885/23945. S2CID 71790662.
=== Enhancement of physical performance === 1-MNA acts as a myokine, supporting the utilization of amino acids for gluconeogenesis in the liver and stimulating lipolysis in adipose tissue, thereby providing energy for muscles. Studies indicate that 1-MNA supplementation improves exercise tolerance and reduces fatigue. After one month of supplementation with 58 mg of 1-MNA, post-COVID-19 patients reported improved distances in a 6-minute walk test (6MWT), with 92% of participants experiencing better outcomes compared to controls. Additional studies highlight 1-MNA's ability to enhance physical performance by stimulating PGI2 release, protecting microcirculation, and ensuring adequate blood flow to muscle tissues. This mechanism may reduce cardiovascular risks associated with physical exertion, particularly in individuals with impaired endothelial response.
=== Helicopter evacuation and capture === Following Ceaușescu's second failed attempt to address the crowd, he and Elena fled into a lift headed for the roof. A group of protesters managed to force their way into the building, overpowered Ceaușescu's bodyguards and made their way through his office before heading onto the balcony. They were unaware they were only a few metres from Ceaușescu. The lift's electricity failed just before it reached the top floor, and Ceaușescu's bodyguards forced it open and ushered the couple onto the roof. At 11:20 on 22 December 1989, Ceaușescu's personal pilot, Lieutenant Colonel Vasile Maluțan, received instructions from Lieutenant General Opruta to proceed to Palace Square to pick up the president. As he flew over Palace Square he saw it was impossible to land there. Maluțan landed his white Dauphin, #203, on the terrace at 11:44. A man brandishing a white net curtain from one of the windows waved him down. Maluțan said, "Then Stelică, the co-pilot, came to me and said that there were demonstrators coming to the terrace. Then the Ceaușescus came out, both practically carried by their bodyguards ... They looked as if they were fainting. They were white with terror. Manea Mănescu [one of the vice-presidents] and Emil Bobu were running behind them. Mănescu, Bobu, Neagoe and another Securitate officer scrambled to the four seats in the back ... As I pulled Ceaușescu in, I saw the demonstrators running across the terrace ... There wasn't enough space, Elena Ceaușescu and I were squeezed in between the chairs and the door ...
In 2011, a number of former Hooters executives left to start the Twin Peaks franchise group. Hooters filed suit and alleged that former Hooters executives stole trade secrets and management documents as part as their move to the new restaurant chain. In 2012, former employee Jheri Stratton filed suit after catching tuberculosis from one of her managers. Also in 2012, Kisuk Cha, a Korean American immigrant who placed a takeout order at a Hooters in Queens, New York, sued the restaurant chain for racial discrimination after noticing a racial slur printed on a cash register receipt by a hostess who later confessed and subsequently resigned. The case was dismissed in 2013. On April 2, 2015, former employee Farryn Johnson was awarded $250,000 after an arbitrator found that racial discrimination contributed to her termination. Johnson was terminated in August 2013 after her store manager (from the Hooters in Baltimore, Maryland) told her that she could not have blonde highlights in her hair. Johnson filed a civil rights complaint with the State of Maryland Civil Rights Division where her attorneys stated the applicability of the dress code for Black Americans and everyone else (e.g. non-Hispanic Whites, Hispanic/Latino, Asian/Pacific Islander American) where one set of policies pertains to a certain group of people was considered as racial discrimination.
Sources: en.wikipedia.org
Over-the-counter preparations containing dextromethorphan have been used in manners inconsistent with their labeling, often as a recreational drug. At doses much higher than medically recommended, dextromethorphan and its major metabolite dextrorphan act as NMDA receptor antagonists, producing dissociative hallucinogenic states somewhat similar to those of ketamine and phencyclidine. It may produce distortions of the visual field, feelings of dissociation, distorted bodily perception, excitement, and a loss of sense of time. Some users report stimulant-like euphoria, particularly in response to music. Dextromethorphan usually provides its recreational effects in a non-linear fashion, so that they are experienced in significantly varied stages. These stages are commonly referred to as "plateaus". These plateaus are numbered from one to four, with the first having the mildest effects to fourth being the most intense. Each plateau is said to come with different related effects and experiences. The first plateau is said to induce music euphoria and mild stimulation, likened to that of MDMA. The second plateau is likened to a state of being on moderate amounts of alcohol and cannabis at the same time, featuring euphoria, sedation and minor hallucinations. The third plateau induces a significant dissociative state which can often cause anxiety in users. Reaching the fourth plateau is said to cause extreme sedation and a significant hallucinatory state as well as complete dissociation from reality.
The neuroendocrine system is an integrated system composed of neurons, glands and non-endocrine tissues, and the hormones and neurochemicals they produce and receive collectively regulate physiological or behavioral state.
=== L’Art islamique en Orient I, II and III (Islamic Art in the East I, II and III) === In 1922, he worked on publishing the first book of his Islamic art reproductions, Alttürkishe Keramik or L’Art islamique en Orient – Première Partie (Islamic Art in the East – Part One, published in French). In 1923, with the financial backing of American millionaire Charles Crane, he commissioned the printing of L’Art islamique en Orient, Deuxième Partie (Fragments d’architecture religieuse et civile) (Islamic Art in the East, Part Two (Fragments of Religious and Civil Architecture)) and L’Art islamique en Orient, Troisième Partie (Islamic Art in the East, Part Three), published in French in Prague by the Printing House Schulz.
Gram staining is used to determine gram status to classifying bacteria broadly based on the composition of their cell wall. Gram staining uses crystal violet to stain cell walls, iodine (as a mordant), and a fuchsin or safranin counterstain to (mark all bacteria). Gram status, helps divide specimens of bacteria into two groups, generally representative of their underlying phylogeny. This characteristic, in combination with other techniques makes it a useful tool in clinical microbiology laboratories, where it can be important in early selection of appropriate antibiotics. On most Gram-stained preparations, Gram-negative organisms appear red or pink due to their counterstain. Due to the presence of higher lipid content, after alcohol-treatment, the porosity of the cell wall increases, hence the CVI complex (crystal violet – iodine) can pass through. Thus, the primary stain is not retained. In addition, in contrast to most Gram-positive bacteria, Gram-negative bacteria have only a few layers of peptidoglycan and a secondary cell membrane made primarily of lipopolysaccharide.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
The molecule lacks aromatic residues, so it absorbs weakly near 280 nanometres, the wavelength applied to many other peptides. The peptide bond absorbs strongly below 220 nanometres, making 214 nanometres a practical compromise. Gradient methods must therefore use mobile phases with low ultraviolet absorbance to keep the baseline clean.
Neutral and slightly basic aqueous conditions promote aspartimide formation at the aspartate-glycine step, often followed by deamidation. Elevated temperature and repeated freeze-thaw cycles accelerate the loss. Acidic solutions and dry lyophilised powder are comparatively stable over short periods.
No monograph exists in the United States Pharmacopeia or the European Pharmacopoeia, and no widely distributed certified reference standard is available. Purity and identity therefore rest on supplier methods that are not harmonised. This absence is the main reason reported purities are difficult to compare between sources.
It is a synthetic tetrapeptide built from alanine, glutamate, aspartate and glycine. The four residues are joined by standard peptide bonds, giving a linear chain rather than a branched structure.